NDRG2 polyclonal antibody
  • NDRG2 polyclonal antibody

NDRG2 polyclonal antibody

Ref: AB-PAB28730
NDRG2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NDRG2.
Información adicional
Size 100 uL
Gene Name NDRG2
Gene Alias DKFZp781G1938|FLJ25522|KIAA1248|SYLD
Gene Description NDRG family member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC,IF
Immunogen Prot. Seq TGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIELYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQP
Form Liquid
Recomended Dilution Immunohistochemistry (1:2500-1:5000)
Immunofluorescence (1-4 ug/ml)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NDRG2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 57447
Iso type IgG

Enviar un mensaje


NDRG2 polyclonal antibody

NDRG2 polyclonal antibody