AKT1 polyclonal antibody
  • AKT1 polyclonal antibody

AKT1 polyclonal antibody

Ref: AB-PAB28728
AKT1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant AKT1.
Información adicional
Size 100 uL
Gene Name AKT1
Gene Alias AKT|MGC99656|PKB|PKB-ALPHA|PRKBA|RAC|RAC-ALPHA
Gene Description v-akt murine thymoma viral oncogene homolog 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC,IF
Immunogen Prot. Seq ERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/ml)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human AKT1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 207
Iso type IgG

Enviar un mensaje


AKT1 polyclonal antibody

AKT1 polyclonal antibody