PCMT1 polyclonal antibody
  • PCMT1 polyclonal antibody

PCMT1 polyclonal antibody

Ref: AB-PAB28722
PCMT1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PCMT1.
Información adicional
Size 100 uL
Gene Name PCMT1
Gene Alias -
Gene Description protein-L-isoaspartate (D-aspartate) O-methyltransferase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC,IF
Immunogen Prot. Seq AKALDVGSGSGILTACFARMVGCTGKVIGIDHIKELVDDSVNNVRKDDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQMLEQYDKLQDGSIKMKPLMGVIYVPLTDKEKQWS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/ml)
Western Blot (1:100-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PCMT1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5110
Iso type IgG

Enviar un mensaje


PCMT1 polyclonal antibody

PCMT1 polyclonal antibody