SLC44A2 polyclonal antibody
  • SLC44A2 polyclonal antibody

SLC44A2 polyclonal antibody

Ref: AB-PAB28721
SLC44A2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC44A2.
Información adicional
Size 100 uL
Gene Name SLC44A2
Gene Alias CTL2|DKFZp666A071|FLJ44586|PP1292
Gene Description solute carrier family 44, member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC,IF
Immunogen Prot. Seq NENKPYLFYFNIVKCASPLVLLEFQCPTPQICVEKCPDRYLTYLNARSSRDFEYYKQFCVPGFKNNKGVAEVLRDGDCPAVLIPSKPLARRCFPAIHAYKGVLMVGNETTYEDGHGSRKNITDLVE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC44A2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57153
Iso type IgG

Enviar un mensaje


SLC44A2 polyclonal antibody

SLC44A2 polyclonal antibody