ZNF155 polyclonal antibody
  • ZNF155 polyclonal antibody

ZNF155 polyclonal antibody

Ref: AB-PAB28720
ZNF155 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF155.
Información adicional
Size 100 uL
Gene Name ZNF155
Gene Alias MGC161655|pHZ-96
Gene Description zinc finger protein 155
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC,IF
Immunogen Prot. Seq TCHFLREEKFWMMGTATQREGNSGGKIQTELESVPEAGAHEEWSCQQIWEQIAKDLTRSQDSIINNSQFFENGDVPSQVEAGLPTIHTGQKPSQGGKCKQSFSDVPIFDLPQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/ml)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF155.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7711
Iso type IgG

Enviar un mensaje


ZNF155 polyclonal antibody

ZNF155 polyclonal antibody