PSMD5 polyclonal antibody
  • PSMD5 polyclonal antibody

PSMD5 polyclonal antibody

Ref: AB-PAB28719
PSMD5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PSMD5.
Información adicional
Size 100 uL
Gene Name PSMD5
Gene Alias KIAA0072|MGC23145|S5B
Gene Description proteasome (prosome, macropain) 26S subunit, non-ATPase, 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC,IF
Immunogen Prot. Seq AAQALALLREVARLEAPLEELRALHSVLQAVPLNELRQQAAELRLGPLFSLLNENHREKTTLCVSILERLLQAMEPVHVARNLRVDLQRGLIHPDDSVKILTLSQIGRIVENSDAVTEILNNAELLKQIVYCIGGENLS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/ml)
Western Blot (1:100-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PSMD5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5711
Iso type IgG

Enviar un mensaje


PSMD5 polyclonal antibody

PSMD5 polyclonal antibody