SAGE1 polyclonal antibody
  • SAGE1 polyclonal antibody

SAGE1 polyclonal antibody

Ref: AB-PAB28717
SAGE1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SAGE1.
Información adicional
Size 100 uL
Gene Name SAGE1
Gene Alias SAGE
Gene Description sarcoma antigen 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC,IF
Immunogen Prot. Seq HSVREEKMESGKPQTDKVISNDAPQLGHMAAGGIPSMSTKDLYATVTQNVHEERMENNQPQPSYDLSTVLPGLTYLTVAGIPAMSTRDQYATVTHNVHEEKIKNGQAASDNVFSTVPPAFINMAATGVSSMSTRDQYAAVTHNIR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SAGE1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55511
Iso type IgG

Enviar un mensaje


SAGE1 polyclonal antibody

SAGE1 polyclonal antibody