ZNF764 polyclonal antibody
  • ZNF764 polyclonal antibody

ZNF764 polyclonal antibody

Ref: AB-PAB28715
ZNF764 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF764.
Información adicional
Size 100 uL
Gene Name ZNF764
Gene Alias MGC13138
Gene Description zinc finger protein 764
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC
Immunogen Prot. Seq VYFCREEWGCLRPAQRALYRDVMRETYGHLSALGIGGNKPALISWVEEEAELWGPAAQDPEVAKCQTQTDPDSRNKKKERQREGTGALEKPDPVAAGSPGLKSPQAPSAGPPYGWEQLSKAPHRGRPSLCAHPPVPRADQRH
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF764.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 92595
Iso type IgG

Enviar un mensaje


ZNF764 polyclonal antibody

ZNF764 polyclonal antibody