NLGN3 polyclonal antibody
  • NLGN3 polyclonal antibody

NLGN3 polyclonal antibody

Ref: AB-PAB28709
NLGN3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NLGN3.
Información adicional
Size 100 uL
Gene Name NLGN3
Gene Alias ASPGX1|AUTSX1|HNL3|KIAA1480
Gene Description neuroligin 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC
Immunogen Prot. Seq APAPTVNTHFGKLRGARVPLPSEILGPVDQYLGVPYAAPPIGEKRFLPPEPPPSWSGIRNATHFPPVCPQNIHTAVPEVMLPVWFTANLDIVATYIQEPNEDCLYLNVYVPTED
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NLGN3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54413
Iso type IgG

Enviar un mensaje


NLGN3 polyclonal antibody

NLGN3 polyclonal antibody