MED15 polyclonal antibody
  • MED15 polyclonal antibody

MED15 polyclonal antibody

Ref: AB-PAB28707
MED15 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MED15.
Información adicional
Size 100 uL
Gene Name MED15
Gene Alias ARC105|CAG7A|CTG7A|DKFZp686A2214|DKFZp762B1216|FLJ42282|FLJ42935|PCQAP|TIG-1|TIG1|TNRC7
Gene Description mediator complex subunit 15
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC,IF
Immunogen Prot. Seq QKLVSQIEDAMRKAGVAHSKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIHNKKSQASVSDPMNALQSLTGGPAAGAAGIGMPPRGPGQSLGGMGSLGAMGQPMSLSGQP
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Immunofluorescence (1-4 ug/ml)
Western Blot (1:100-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MED15.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51586
Iso type IgG

Enviar un mensaje


MED15 polyclonal antibody

MED15 polyclonal antibody