RAB3A polyclonal antibody
  • RAB3A polyclonal antibody

RAB3A polyclonal antibody

Ref: AB-PAB28701
RAB3A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RAB3A.
Información adicional
Size 100 uL
Gene Name RAB3A
Gene Alias -
Gene Description RAB3A, member RAS oncogene family
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC
Immunogen Prot. Seq RIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLVGNKCDMEDERVVSSERGRQLADHLGFEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPAVTGAKQGPQLSDQQV
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RAB3A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5864
Iso type IgG

Enviar un mensaje


RAB3A polyclonal antibody

RAB3A polyclonal antibody