SDHB polyclonal antibody
  • SDHB polyclonal antibody

SDHB polyclonal antibody

Ref: AB-PAB28696
SDHB polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SDHB, subunit B.
Información adicional
Size 100 uL
Gene Name SDHB
Gene Alias FLJ92337|IP|PGL4|SDH|SDH1|SDHIP
Gene Description succinate dehydrogenase complex, subunit B, iron sulfur (Ip)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC
Immunogen Prot. Seq EGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATY
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:100-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SDHB.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 6390
Iso type IgG

Enviar un mensaje


SDHB polyclonal antibody

SDHB polyclonal antibody