Ver mas grande
SDHB polyclonal antibody
AB-PAB28696
Producto nuevo
SDHB polyclonal antibody
Comprando este producto generará 6 Biopuntos. Su cesta contiene un total 6 Biopuntos puede ser convertido en un Biobonos Descuento 24.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | SDHB |
| Gene Alias | FLJ92337|IP|PGL4|SDH|SDH1|SDHIP |
| Gene Description | succinate dehydrogenase complex, subunit B, iron sulfur (Ip) |
| Storage Conditions | Store at 4ºC. For long term storage store at -20ºC.<br>Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Ce,IHC |
| Immunogen Prot. Seq | EGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATY |
| Form | Liquid |
| Recomended Dilution | Immunohistochemistry (1:500-1:1000)<br> Western Blot (1:100-1:500)<br>The optimal working dilution should be determined by the end user. |
| Antigen species Target species | Human |
| Immunogen | Recombinant protein corresponding to amino acids of human SDHB. |
| Storage Buffer | In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide). |
| Gene ID | 6390 |
| Iso type | IgG |
Más información
Rabbit polyclonal antibody raised against recombinant SDHB, subunit B.