RPS6KA6 polyclonal antibody
  • RPS6KA6 polyclonal antibody

RPS6KA6 polyclonal antibody

Ref: AB-PAB28694
RPS6KA6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RPS6KA6.
Información adicional
Size 100 uL
Gene Name RPS6KA6
Gene Alias RSK4
Gene Description ribosomal protein S6 kinase, 90kDa, polypeptide 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC,IF
Immunogen Prot. Seq PFKPASGKPDDTFCFDPEFTAKTPKDSPGLPASANAHQLFKGFSFVATSIAEEYKITPITSANVLPIVQINGNAAQFGEVYELKEDIGVGSYSVCKRCIHATTNMEFAVKIIDKSK
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RPS6KA6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 27330
Iso type IgG

Enviar un mensaje


RPS6KA6 polyclonal antibody

RPS6KA6 polyclonal antibody