EMILIN1 polyclonal antibody
  • EMILIN1 polyclonal antibody

EMILIN1 polyclonal antibody

Ref: AB-PAB28690
EMILIN1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EMILIN1.
Información adicional
Size 100 uL
Gene Name EMILIN1
Gene Alias DKFZp586M121|EMILIN|EMILIN-1|gp115
Gene Description elastin microfibril interfacer 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC
Immunogen Prot. Seq PQSIMYRRFLRPRYRVAYKTVTDMEWRCCQGYGGDDCAESPAPALGPASSTPRPLARPARPNLSGSSAGSPLSGLGGEGPGESEKVQQLEEQVQSLTKELQGLRGVLQGLSGRLAEDVQRAVETAFNGRQQPADAAARPGVHETLNE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human EMILIN1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 11117
Iso type IgG

Enviar un mensaje


EMILIN1 polyclonal antibody

EMILIN1 polyclonal antibody