NDUFB7 polyclonal antibody
  • NDUFB7 polyclonal antibody

NDUFB7 polyclonal antibody

Ref: AB-PAB28689
NDUFB7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NDUFB7, beta subcomplex 1.
Información adicional
Size 100 uL
Gene Name NDUFB7
Gene Alias B18|CI-B18|MGC2480
Gene Description NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 7, 18kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC
Immunogen Prot. Seq FPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKV
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:100-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NDUFB7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4713
Iso type IgG

Enviar un mensaje


NDUFB7 polyclonal antibody

NDUFB7 polyclonal antibody