UQCRC1 polyclonal antibody
  • UQCRC1 polyclonal antibody

UQCRC1 polyclonal antibody

Ref: AB-PAB28688
UQCRC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant UQCRC1.
Información adicional
Size 100 uL
Gene Name UQCRC1
Gene Alias D3S3191|QCR1|UQCR1
Gene Description ubiquinol-cytochrome c reductase core protein I
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC
Immunogen Prot. Seq GDIVQNCSLEDSQIEKERDVILREMQENDASMRDVVFNYLHATAFQGTPLAQAVEGPSENVRKLSRADLTEYLSTHYKAPRMVLAAAGGVEHQQLLDLAQKHLGG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human UQCRC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 7384
Iso type IgG

Enviar un mensaje


UQCRC1 polyclonal antibody

UQCRC1 polyclonal antibody