ZNF544 polyclonal antibody
  • ZNF544 polyclonal antibody

ZNF544 polyclonal antibody

Ref: AB-PAB28684
ZNF544 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF544.
Información adicional
Size 100 uL
Gene Name ZNF544
Gene Alias -
Gene Description zinc finger protein 544
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC,IF
Immunogen Prot. Seq HQRTHTGEKPYECNLCGKSFSQSSKLITHQRIHTGEKPYQCIECGKSFRWNSNLVIHQRIHTGEKPYDCTHCGKSFSQSYQLVAHKRTHTGEKPYECNECGKAFNRSTQLIRHLQIHTGEKPYKCNQCNKA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF544.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 27300
Iso type IgG

Enviar un mensaje


ZNF544 polyclonal antibody

ZNF544 polyclonal antibody