IFIH1 polyclonal antibody
  • IFIH1 polyclonal antibody

IFIH1 polyclonal antibody

Ref: AB-PAB28678
IFIH1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IFIH1, domain 1.
Información adicional
Size 100 uL
Gene Name IFIH1
Gene Alias Hlcd|IDDM19|MDA-5|MDA5|MGC133047
Gene Description interferon induced with helicase C domain 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC
Immunogen Prot. Seq TIRMIDAYTHLETFYNEEKDKKFAVIEDDSDEGGDDEYCDGDEDEDDLKKPLKLDETDRFLMTLFFENNKMLKRLAENPEYENEKLTKLRNTIMEQYTRTEESARGIIFTKTRQSAYALSQWITENEKFAEVGVKAHHLIGAGHSSEFKP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IFIH1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 64135
Iso type IgG

Enviar un mensaje


IFIH1 polyclonal antibody

IFIH1 polyclonal antibody