ERH polyclonal antibody
  • ERH polyclonal antibody

ERH polyclonal antibody

Ref: AB-PAB28673
ERH polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ERH.
Información adicional
Size 100 uL
Gene Name ERH
Gene Alias DROER|FLJ27340
Gene Description enhancer of rudimentary homolog (Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC
Immunogen Prot. Seq LVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQPYNKDWIKEKIYVLLRRQAQQAGK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ERH.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 2079
Iso type IgG

Enviar un mensaje


ERH polyclonal antibody

ERH polyclonal antibody