SND1 polyclonal antibody
  • SND1 polyclonal antibody

SND1 polyclonal antibody

Ref: AB-PAB28672
SND1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SND1.
Información adicional
Size 100 uL
Gene Name SND1
Gene Alias TDRD11|p100
Gene Description staphylococcal nuclease and tudor domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC
Immunogen Prot. Seq ARAIKNGKGLHSKKEVPIHRVADISGDTQKAKQFLPFLQRAGRSEAVVEYVFSGSRLKLYLPKETCLITFLLAGIECPRGARNLPGLVQEGEPFSEEATLFTKEL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SND1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 27044
Iso type IgG

Enviar un mensaje


SND1 polyclonal antibody

SND1 polyclonal antibody