GCET2 polyclonal antibody
  • GCET2 polyclonal antibody

GCET2 polyclonal antibody

Ref: AB-PAB28669
GCET2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant GCET2.
Información adicional
Size 100 uL
Gene Name GCET2
Gene Alias GCAT2|HGAL|MGC40441
Gene Description germinal center expressed transcript 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC
Immunogen Prot. Seq HIAEGCFCLPWKKILIFEKRQDSQNENERMSSTPIQDNVDQTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRESLGGTETEYSLLHMPSTDPRHARSPEDEYELLMPHRISSHFL
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human GCET2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 257144
Iso type IgG

Enviar un mensaje


GCET2 polyclonal antibody

GCET2 polyclonal antibody