LAX1 polyclonal antibody
  • LAX1 polyclonal antibody

LAX1 polyclonal antibody

Ref: AB-PAB28667
LAX1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LAX1.
Información adicional
Size 100 uL
Gene Name LAX1
Gene Alias FLJ20340|LAX
Gene Description lymphocyte transmembrane adaptor 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC
Immunogen Prot. Seq AEDSDSLSNGEGSSQISNDYVNMTGLDLSAIQERQLWVAFQCCRDYENVPAADPSGSQQQAEKDVPSSNIGHVEDKTDDPGTHVQCVKRTFLASGDYADFQPFTQSEDSQMKHREEMSNEDSSDYENVLTAKLGGRDSEQGP
Form liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LAX1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54900
Iso type IgG

Enviar un mensaje


LAX1 polyclonal antibody

LAX1 polyclonal antibody