PSMC4 polyclonal antibody
  • PSMC4 polyclonal antibody

PSMC4 polyclonal antibody

Ref: AB-PAB28661
PSMC4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PSMC4.
Información adicional
Size 100 uL
Gene Name PSMC4
Gene Alias MGC13687|MGC23214|MGC8570|MIP224|S6|TBP7
Gene Description proteasome (prosome, macropain) 26S subunit, ATPase, 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq LEDLYSRYKKLQQELEFLEVQEEYIKDEQKNLKKEFLHAQEEVKRIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVRILSTIDRELLKPNASVALHKHSNA
Form liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)(1:200-1:500)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PSMC4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5704
Iso type IgG

Enviar un mensaje


PSMC4 polyclonal antibody

PSMC4 polyclonal antibody