USP51 polyclonal antibody
  • USP51 polyclonal antibody

USP51 polyclonal antibody

Ref: AB-PAB28659
USP51 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant USP51.
Información adicional
Size 100 uL
Gene Name USP51
Gene Alias -
Gene Description ubiquitin specific peptidase 51
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq LRLIYQRFVWSGTPETRKRKAKSCICHVCSTHMNRLHSCLSCVFFGCFTEKHIHKHAETKQHHLAVDLYHGVIYCFMCKDYVYDKDIEQIAKETKEKILRLLTSTSTDVSHQQFMTSGFEDKQSTCETKEQEP
Form liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)(1:50-1:200)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human USP51.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 158880
Iso type IgG

Enviar un mensaje


USP51 polyclonal antibody

USP51 polyclonal antibody