SH2D4A polyclonal antibody
  • SH2D4A polyclonal antibody

SH2D4A polyclonal antibody

Ref: AB-PAB28654
SH2D4A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SH2D4A.
Información adicional
Size 100 uL
Gene Name SH2D4A
Gene Alias FLJ20967|SH2A
Gene Description SH2 domain containing 4A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq LFFKMREEQIRRWKEREAAMERKESLPVKPRPKKENGKSVHWKLGADKEVWVWVMGEHHLDKPYDVLCNEIIAERARLKAEQEAEEPRKTHSEEFTNSLKTKSQYHDLQAPDNQQTKDIWKKVA
Form liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)(1:200-1:500)
Immunofluorescence (1-4 ug/ml)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SH2D4A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 63898
Iso type IgG

Enviar un mensaje


SH2D4A polyclonal antibody

SH2D4A polyclonal antibody