NDP polyclonal antibody
  • NDP polyclonal antibody

NDP polyclonal antibody

Ref: AB-PAB28650
NDP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NDP.
Información adicional
Size 100 uL
Gene Name NDP
Gene Alias EVR2|FEVR|ND
Gene Description Norrie disease (pseudoglioma)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TDSSFIMDSDPRRCMRHHYVDSISHPLYKCSSKMVLLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHCCRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEECNS
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NDP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4693
Iso type IgG

Enviar un mensaje


NDP polyclonal antibody

NDP polyclonal antibody