MDP-1 polyclonal antibody
  • MDP-1 polyclonal antibody

MDP-1 polyclonal antibody

Ref: AB-PAB28644
MDP-1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MDP-1.
Información adicional
Size 100 uL
Gene Name MDP-1
Gene Alias MGC5987
Gene Description magnesium-dependent phosphatase 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERRNIVDVSKLGVTCIHIQNGMNLQT
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MDP-1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 145553
Iso type IgG

Enviar un mensaje


MDP-1 polyclonal antibody

MDP-1 polyclonal antibody