CASP1 polyclonal antibody
  • CASP1 polyclonal antibody

CASP1 polyclonal antibody

Ref: AB-PAB28642
CASP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CASP1.
Información adicional
Size 100 uL
Gene Name CASP1
Gene Alias ICE|IL1BC|P45
Gene Description caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta, convertase)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq PDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CASP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 834
Iso type IgG

Enviar un mensaje


CASP1 polyclonal antibody

CASP1 polyclonal antibody