PSMA6 polyclonal antibody
  • PSMA6 polyclonal antibody

PSMA6 polyclonal antibody

Ref: AB-PAB28640
PSMA6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PSMA6.
Información adicional
Size 100 uL
Gene Name PSMA6
Gene Alias IOTA|MGC22756|MGC2333|MGC23846|PROS27|p27K
Gene Description proteasome (prosome, macropain) subunit, alpha type, 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq EAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHL
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PSMA6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5687
Iso type IgG

Enviar un mensaje


PSMA6 polyclonal antibody

PSMA6 polyclonal antibody