TST polyclonal antibody
  • TST polyclonal antibody

TST polyclonal antibody

Ref: AB-PAB28638
TST polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TST.
Información adicional
Size 100 uL
Gene Name TST
Gene Alias MGC19578|RDS
Gene Description thiosulfate sulfurtransferase (rhodanese)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq RSLLKTYEQVLENLESKRFQLVDSRSQGRFLGTEPEPDAVGLDSGHIRGAVNMPFMDFLTEDGFEKGPEELRALFQTKKVDLSQPLIATCRKGVTACHVALAAYLCGKPDVAVYDGSWSEWFRRAPPESRVSQGKS
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TST.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 7263
Iso type IgG

Enviar un mensaje


TST polyclonal antibody

TST polyclonal antibody