TOMM22 polyclonal antibody
  • TOMM22 polyclonal antibody

TOMM22 polyclonal antibody

Ref: AB-PAB28636
TOMM22 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TOMM22.
Información adicional
Size 100 uL
Gene Name TOMM22
Gene Alias 1C9-2|MST065|MSTP065|TOM22
Gene Description translocase of outer mitochondrial membrane 22 homolog (yeast)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TOMM22.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56993
Iso type IgG

Enviar un mensaje


TOMM22 polyclonal antibody

TOMM22 polyclonal antibody