ASB9 polyclonal antibody
  • ASB9 polyclonal antibody

ASB9 polyclonal antibody

Ref: AB-PAB28630
ASB9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ASB9.
Información adicional
Size 100 uL
Gene Name ASB9
Gene Alias DKFZp564L0862|FLJ20636|MGC4954
Gene Description ankyrin repeat and SOCS box-containing 9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq GMDGSKPAGPRDFPGIRLLSNPLMGDAVSDWSPMHEAAIHGHQLSLRNLISQGWAVNIITADHVSPLHEACLGGHLSCVKILLKHGAQVNGVTADWHTPLFNACV
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ASB9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 140462
Iso type IgG

Enviar un mensaje


ASB9 polyclonal antibody

ASB9 polyclonal antibody