DLST polyclonal antibody
  • DLST polyclonal antibody

DLST polyclonal antibody

Ref: AB-PAB28629
DLST polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DLST.
Información adicional
Size 100 uL
Gene Name DLST
Gene Alias DLTS
Gene Description dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P
Immunogen Prot. Seq QNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPII
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DLST.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1743
Iso type IgG

Enviar un mensaje


DLST polyclonal antibody

DLST polyclonal antibody