CTSS polyclonal antibody
  • CTSS polyclonal antibody

CTSS polyclonal antibody

Ref: AB-PAB28624
CTSS polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CTSS.
Información adicional
Size 100 uL
Gene Name CTSS
Gene Alias MGC3886
Gene Description cathepsin S
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq NGGFMTTAFQYIIDNKGIDSDASYPYKAMDQKCQYDSKYRAATCSKYTELPYGREDVLKEAVANKGPVSVGVDARHPSFFLYRSGVYYEPSCTQNVNHGVLVVGYGDLNGKEYWLVKNSWGHNFGEEGYIRMARNKGNHCG
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CTSS.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1520
Iso type IgG

Enviar un mensaje


CTSS polyclonal antibody

CTSS polyclonal antibody