CADM3 polyclonal antibody
  • CADM3 polyclonal antibody

CADM3 polyclonal antibody

Ref: AB-PAB28623
CADM3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CADM3.
Información adicional
Size 100 uL
Gene Name CADM3
Gene Alias BIgR|FLJ10698|IGSF4B|NECL1|Necl-1|TSLL1|synCAM3
Gene Description cell adhesion molecule 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq QLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CADM3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57863
Iso type IgG

Enviar un mensaje


CADM3 polyclonal antibody

CADM3 polyclonal antibody