SKAP1 polyclonal antibody
  • SKAP1 polyclonal antibody

SKAP1 polyclonal antibody

Ref: AB-PAB28622
SKAP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SKAP1.
Información adicional
Size 100 uL
Gene Name SKAP1
Gene Alias SCAP1|SKAP55
Gene Description src kinase associated phosphoprotein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq SLTIPYEEDEEEEEKEETYDDIDGFDSPSCGSQCRPTILPGSVGIKEPTEEKEEEDIYEVLPDEEHDLEEDESGTRRKGVDYASYYQGLWDCHGDQPDELSFQRGDL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SKAP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8631
Iso type IgG

Enviar un mensaje


SKAP1 polyclonal antibody

SKAP1 polyclonal antibody