POLA1 polyclonal antibody
  • POLA1 polyclonal antibody

POLA1 polyclonal antibody

Ref: AB-PAB28620
POLA1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant POLA1.
Información adicional
Size 100 uL
Gene Name POLA1
Gene Alias DKFZp686K1672|POLA|p180
Gene Description polymerase (DNA directed), alpha 1, catalytic subunit
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq VDLEPMAAKAWDKESEPAEEVKQEADSGKGTVSYLGSFLPDVSCWDIDQEGDSSFSVQEVQVDSSHLPLVKGADEEQVFHFYWLDAYEDQYNQPGVVFLFGKVWIESAETHVSCCVMVK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human POLA1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5422
Iso type IgG

Enviar un mensaje


POLA1 polyclonal antibody

POLA1 polyclonal antibody