HCCS polyclonal antibody
  • HCCS polyclonal antibody

HCCS polyclonal antibody

Ref: AB-PAB28619
HCCS polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HCCS.
Información adicional
Size 100 uL
Gene Name HCCS
Gene Alias CCHL|DKFZp779I1858|MCOPS7
Gene Description holocytochrome c synthase (cytochrome c heme-lyase)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq YVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYEL
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:100-1:25)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HCCS.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 3052
Iso type IgG

Enviar un mensaje


HCCS polyclonal antibody

HCCS polyclonal antibody