TIMM9 polyclonal antibody
  • TIMM9 polyclonal antibody

TIMM9 polyclonal antibody

Ref: AB-PAB28616
TIMM9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TIMM9.
Información adicional
Size 100 uL
Gene Name TIMM9
Gene Alias TIM9|TIM9A
Gene Description translocase of inner mitochondrial membrane 9 homolog (yeast)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq AAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TIMM9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26520
Iso type IgG

Enviar un mensaje


TIMM9 polyclonal antibody

TIMM9 polyclonal antibody