CGRRF1 polyclonal antibody
  • CGRRF1 polyclonal antibody

CGRRF1 polyclonal antibody

Ref: AB-PAB28615
CGRRF1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CGRRF1.
Información adicional
Size 100 uL
Gene Name CGRRF1
Gene Alias CGR19|RNF197
Gene Description cell growth regulator with ring finger domain 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq IYDIISMVSVIHIPDRTYKLSCRILYQYLLLAQGQFHDLKQLFMSANNNFTPSNNSSSEEKNTDRSLLEKVGLSESEVEPSEENSKDCVVCQNGTVNWVLLPCRHTCLCDGCVKYFQQCPMCRQFVQESFALCSQKEQDKDKPK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:100-1:250)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CGRRF1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10668
Iso type IgG

Enviar un mensaje


CGRRF1 polyclonal antibody

CGRRF1 polyclonal antibody