HECTD1 polyclonal antibody
  • HECTD1 polyclonal antibody

HECTD1 polyclonal antibody

Ref: AB-PAB28614
HECTD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant HECTD1.
Información adicional
Size 100 uL
Gene Name HECTD1
Gene Alias FLJ38315|KIAA1131
Gene Description HECT domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RHWKLTGTNKSIRKNRNCSQLIAAYKDFCEHGTKSGLNQGAISTLQSSDILNLTKEQPQAKAGNGQNSCGVEDVLQLLRILYIVASDPYSRISQEDGDEQPQFTFPPDE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human HECTD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 25831
Iso type IgG

Enviar un mensaje


HECTD1 polyclonal antibody

HECTD1 polyclonal antibody