ENTPD5 polyclonal antibody
  • ENTPD5 polyclonal antibody

ENTPD5 polyclonal antibody

Ref: AB-PAB28613
ENTPD5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ENTPD5.
Información adicional
Size 100 uL
Gene Name ENTPD5
Gene Alias CD39L4|MGC163357|MGC163359|NTPDase-5|PCPH
Gene Description ectonucleoside triphosphate diphosphohydrolase 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AGSTGTRIHVYTFVQKMPGQLPILEGEVFDSVKPGLSAFVDQPKQGAETVQGLLEVAKDSIPRSHWKKTPVVLKATAGLRLLPEHKAKALLFEVKEIFRKSPFLVPKGSVSIMDGSDEGILAWVTVNFLTGQLHGHRQETVGTL
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ENTPD5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 957
Iso type IgG

Enviar un mensaje


ENTPD5 polyclonal antibody

ENTPD5 polyclonal antibody