PSMD10 polyclonal antibody
  • PSMD10 polyclonal antibody

PSMD10 polyclonal antibody

Ref: AB-PAB28611
PSMD10 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PSMD10.
Información adicional
Size 100 uL
Gene Name PSMD10
Gene Alias dJ889N15.2|p28
Gene Description proteasome (prosome, macropain) 26S subunit, non-ATPase, 10
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq EGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPL
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/ml)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PSMD10.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5716
Iso type IgG

Enviar un mensaje


PSMD10 polyclonal antibody

PSMD10 polyclonal antibody