OPHN1 polyclonal antibody
  • OPHN1 polyclonal antibody

OPHN1 polyclonal antibody

Ref: AB-PAB28610
OPHN1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant OPHN1.
Información adicional
Size 100 uL
Gene Name OPHN1
Gene Alias MRX60|OPN1
Gene Description oligophrenin 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RVTARRHKPITISKRLLRERTVFYTSSLDESEDEIQHQTPNGTITSSIEPPKPPQHPKLPIQRSGETDPGRKSPSRPILDGKLEPCPEVDVGKLVSRLQDGGTKITPK
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human OPHN1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 4983
Iso type IgG

Enviar un mensaje


OPHN1 polyclonal antibody

OPHN1 polyclonal antibody