EXDL2 polyclonal antibody
  • EXDL2 polyclonal antibody

EXDL2 polyclonal antibody

Ref: AB-PAB28607
EXDL2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant EXDL2.
Información adicional
Size 100 uL
Gene Name EXDL2
Gene Alias C14orf114|DKFZp781A0133|DKFZp781L15100|FLJ10738
Gene Description exonuclease 3'-5' domain-like 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SKTSPVTQQPQQKVLGSRELPPPEDDQLHSSAPRSSWKERILKAKVVTVSQEAEWDQIEPLLRSELEDFPVLGIDCEWERHGTYLQWLF
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human EXDL2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55218
Iso type IgG

Enviar un mensaje


EXDL2 polyclonal antibody

EXDL2 polyclonal antibody