FBXO8 polyclonal antibody
  • FBXO8 polyclonal antibody

FBXO8 polyclonal antibody

Ref: AB-PAB28605
FBXO8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FBXO8.
Información adicional
Size 100 uL
Gene Name FBXO8
Gene Alias DC10|FBS|FBX8
Gene Description F-box protein 8
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq WRVVRNQQLQQEGYSEQGYLTREQSRRMAASNISNTNHRKQVQGGIDIYHLLKARKSKEQEGFINLEMLPPELSFTILSYLNATDLCLASCVWQDLANDELLWQGLCKSTWGHCSIYNKNPPLGFSFRKLYMQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FBXO8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26269
Iso type IgG

Enviar un mensaje


FBXO8 polyclonal antibody

FBXO8 polyclonal antibody