FRMD8 polyclonal antibody
  • FRMD8 polyclonal antibody

FRMD8 polyclonal antibody

Ref: AB-PAB28602
FRMD8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FRMD8.
Información adicional
Size 100 uL
Gene Name FRMD8
Gene Alias FKSG44|FLJ32216|FLJ90369|MGC31785
Gene Description FERM domain containing 8
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SREKHVLLGLRFQELSWDHTSPEEEEPILWLEFDGDSEGTPVNKLLKIYSKQAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAPVQRPKLRRQGSVVSSRIQHLSTIDYVED
Form Liquid
Recomended Dilution Western Blot (1:100-1:250)
Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FRMD8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 83786
Iso type IgG

Enviar un mensaje


FRMD8 polyclonal antibody

FRMD8 polyclonal antibody