STAG2 polyclonal antibody
  • STAG2 polyclonal antibody

STAG2 polyclonal antibody

Ref: AB-PAB28601
STAG2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant STAG2.
Información adicional
Size 100 uL
Gene Name STAG2
Gene Alias DKFZp686P168|DKFZp781H1753|FLJ25871|SA-2|SA2|bA517O1.1
Gene Description stromal antigen 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LTAKEKKTQLDDRTKITELFAVALPQLLAKYSVDAEKVTNLLQLPQYFDLEIYTTGRLEKHLDALLRQIRNIVEKHTDTDVLEACSKTYHALCNEEFTIFNRVDISRSQLIDELADKFNRLLEDFLQEGE
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human STAG2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10735
Iso type IgG

Enviar un mensaje


STAG2 polyclonal antibody

STAG2 polyclonal antibody