ALG13 polyclonal antibody
  • ALG13 polyclonal antibody

ALG13 polyclonal antibody

Ref: AB-PAB28600
ALG13 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ALG13.
Información adicional
Size 100 uL
Gene Name ALG13
Gene Alias CXorf45|FLJ23018|GLT28D1|MDS031|MGC12423|YGL047W
Gene Description asparagine-linked glycosylation 13 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P
Immunogen Prot. Seq VGTTSFDDLIACVSAPDSLQKIESLGYNRLILQIGRGTVVPEPFSTESFTLDVYRYKDSLKEDIQKADLVISHAGAGSCLETLEKGKPLVVVINEKLMNNHQLELAKQLHKEGHLFYCTCSTLPGLLQSMDLSTLKCYPPG
Form Liquid
Recomended Dilution Western Blot (1:100-1:250)
Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ALG13.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79868
Iso type IgG

Enviar un mensaje


ALG13 polyclonal antibody

ALG13 polyclonal antibody