CNTNAP2 polyclonal antibody
  • CNTNAP2 polyclonal antibody

CNTNAP2 polyclonal antibody

Ref: AB-PAB28596
CNTNAP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CNTNAP2.
Información adicional
Size 100 uL
Gene Name CNTNAP2
Gene Alias AUTS15|CASPR2|CDFE|DKFZp781D1846|NRXN4
Gene Description contactin associated protein-like 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq CNKDVGAFFEEGMWLRYNFQAPATNARDSSSRVDNAPDQQNSHPDLAQEEIRFSFSTTKAPCILLYISSFTTDFLAVLVKPTGSLQIRYNLGGTREPYNIDVDHRNMANGQPHSVNITRHEKTIFLKLDHYPSVSYHLPSSS
Form Liquid
Recomended Dilution Western Blot (1:100-1:250)
Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CNTNAP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26047
Iso type IgG

Enviar un mensaje


CNTNAP2 polyclonal antibody

CNTNAP2 polyclonal antibody